PDLIM5 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PDLIM5 Antibody: synthetic peptide directed towards the middle region of human PDLIM5. Synthetic peptide located within the following region: RTGTTQSRSFRILAQITGTEHLKESEADNTKKANNSQEPSPQLASSVAST |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 54 kDa |
Gene Name | PDZ and LIM domain 5 |
Database Link | |
Background | PDLIM5 is a LIM domain protein. LIM domains are cysteine-rich double zinc fingers composed of 50 to 60 amino acids that are involved in protein-protein interactions. LIM domain-containing proteins are scaffolds for the formation of multiprotein complexes. The proteins are involved in cytoskeleton organization, cell lineage specification, organ development, and oncogenesis. The encoded protein is also a member of the Enigma class of proteins, a family of proteins that possess a 100-amino acid PDZ domain in the N terminus and 1 to 3 LIM domains in the C terminus. Multiple transcript variants encoding different isoforms have been found for this gene, although not all of them have been fully characterized. |
Synonyms | ENH; ENH1; L9; LIM |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 86%; Guinea pig: 86%; Dog: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.