LRRC66 Rabbit Polyclonal Antibody

SKU
TA336061
Rabbit Polyclonal Anti-LRRC66 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-LRRC66 Antibody: synthetic peptide directed towards the middle region of human LOC339977. Synthetic peptide located within the following region: ELDPSLSGEITASLCKMLTHAEAQRTGDSKERGGTEQSLWDSQMEFSKER
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 98 kDa
Gene Name leucine rich repeat containing 66
Database Link
Background The exact function of LOC339977 remains unknown.
Synonyms leucine rich repeat containing 66
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:LRRC66 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.