OriGene Logo

RGL3 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA336019
Rabbit Polyclonal Anti-RGL3 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY422124 Transient overexpression lysate of ral guanine nucleotide dissociation stimulator-like 3 (RGL3), transcript variant 2 100 ug
$436.00
TP311012 Recombinant protein of human ral guanine nucleotide dissociation stimulator-like 3 (RGL3), 20 µg
20 ug
$737.00

View other "RGL3 or NM_001035223" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-RGL3 Antibody: synthetic peptide directed towards the middle region of human RGL3. Synthetic peptide located within the following region: RNFSSLRAILSALQSNPIYRLKRSWGAVSREPLSTFRKLSQIFSDENNHL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 78 kDa
Gene Name ral guanine nucleotide dissociation stimulator like 3
Database Link
Background RGL3 is a guanine nucleotide exchange factor (GEF) for Ral-A. RGL3 is a potential effector of GTPase HRas and Ras-related protein M-Ras. RGL3 negatively regulates Elk-1-dependent gene induction downstream of HRas and MEKK1.
Synonyms FLJ00153; FLJ32585; FLJ44275; MGC126805; MGC138163
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.