HEPACAM2 Rabbit Polyclonal Antibody

SKU TA335999

Rabbit Polyclonal Anti-HEPACAM2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HEPACAM2 Antibody: synthetic peptide directed towards the middle region of human LOC253012. Synthetic peptide located within the following region: NYSCLVRNPVSEMESDIIMPIIYYGPYGLQVNSDKGLKVGEVFTVDLGEA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 51 kDa
• Gene Name: HEPACAM family member 2
• Database Link:
  NP_001034461
  A8MVW5
• Background: The function of the LOC253012 protein remains unknown.
• Synonyms: MIKI
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Bovine: 86%

Reference Data

• Protein Families: Transmembrane