SI Rabbit Polyclonal Antibody

SKU TA335962

Rabbit Polyclonal Anti-SI Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SI Antibody: synthetic peptide directed towards the N terminal of human SI. Synthetic peptide located within the following region: NSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEFTGPTVSDTLYDVK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 209 kDa
• Gene Name: sucrase-isomaltase
• Database Link:
  NP_001032
  P14410
• Background: SI belongs to the glycosyl hydrolase 31 family. It plays an important role in the final stage of carbohydrate digestion.
• Synonyms: MGC131621; MGC131622
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Metabolic pathways, Starch and sucrose metabolism