CT47A7 Rabbit Polyclonal Antibody

SKU TA335926

Rabbit Polyclonal Anti-CT47A7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CT47A7 Antibody is: synthetic peptide directed towards the C-terminal region of Human CT47A7. Synthetic peptide located within the following region: PDAEEPATEEPTAQEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 29 kDa
• Gene Name: cancer/testis antigen family 47, member A7
• Database Link:
  NP_001073609
  Q5JQC4
• Background: This locus represents a member of the cancer/testis gene family 47. This family, also known as CT47, is comprised of 13 nearly identical loci clustered at Xq24.
• Synonyms: CT47.7
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data