GSG1 Rabbit Polyclonal Antibody

SKU
TA335923
Rabbit Polyclonal Anti-GSG1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-GSG1 Antibody: synthetic peptide directed towards the N terminal of human GSG1. Synthetic peptide located within the following region: NYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGD
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 41 kDa
Gene Name germ cell associated 1
Database Link
Background GSG1 belongs to the GSG1 family. GSG1 may cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum.
Synonyms MGC3146; MGC111023
Note Immunogen Sequence Homology: Human: 100%; Mouse: 80%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:GSG1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.