TRIM43B Rabbit Polyclonal Antibody

SKU TA335888

Rabbit Polyclonal Anti-TRIM43B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TRIM43B Antibody is: synthetic peptide directed towards the N-terminal region of Human TRIM43B. Synthetic peptide located within the following region: CREPSPKMDFKTNILLKNLVTIARKASLWQFLSSEKQICGTHRQTKKMFC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: tripartite motif containing 43B
• Database Link:
  NP_001157936
  A6NCK2
• Background: This gene encodes a member of a family of proteins containing RING-finger, SPRY, and BBC domains. There is no definitive support for transcription of this locus, and the transcript structure is inferred from other family members.
• Synonyms: EG666747; Gm8269
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome