PRSS56 Rabbit Polyclonal Antibody

SKU
TA335882
Rabbit Polyclonal Anti-PRSS56 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PRSS56 Antibody is: synthetic peptide directed towards the N-terminal region of Human PRSS56. Synthetic peptide located within the following region: PLSFLRLSCRSTRSAPNELLWTVTLAEGSRGEQAEEVPVNRILPHPKFDP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 57 kDa
Gene Name protease, serine 56
Database Link
Background This gene encodes a protein that contains a peptidase S1 domain and possesses trypsin-like serine protease activity. The encoded protein may play a role in eye development, and mutations in this gene are a cause of autosomal recessive posterior microphthalmos.
Synonyms MCOP6
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 93%; Pig: 86%; Rat: 85%; Mouse: 85%
Reference Data
Write Your Own Review
You're reviewing:PRSS56 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.