PDXK Rabbit Polyclonal Antibody

SKU TA335764

Rabbit Polyclonal Anti-PDXK Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PDXK Antibody: synthetic peptide directed towards the N terminal of human PDXK. Synthetic peptide located within the following region: PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: pyridoxal (pyridoxine, vitamin B6) kinase
• Database Link:
  NP_003672
  O00764
• Background: PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer. The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: C21orf97; C21orf124; HEL-S-1a; PKH; PNK; PRED79
• Note: Immunogen Sequence Homology: Human: 100%; Sheep: 100%; Bovine: 100%; Dog: 93%; Horse: 93%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Rabbit: 86%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Vitamin B6 metabolism