EGR3 Rabbit Polyclonal Antibody

SKU TA335748

Rabbit Polyclonal Anti-EGR3 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EGR3 Antibody: synthetic peptide directed towards the middle region of human EGR3. Synthetic peptide located within the following region: ALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: early growth response 3
• Database Link:
  NP_004421
  Q06889
• Background: EGR3 is a probable transcription factor involved in muscle spindle development.The gene encodes a transcriptional regulator that belongs to the EGR family of C2H2-type zinc-finger proteins. It is an immediate-early growth response gene which is induced by mitogenic stimulation. The protein encoded by this gene participates in the transcriptional regulation of genes in controling biological rhythm. It may also plays a role in muscle development.
• Synonyms: EGR-3; PILOT
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data