ZNF262 (ZMYM4) Rabbit Polyclonal Antibody

SKU TA335724

Rabbit Polyclonal Anti-ZMYM4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZMYM4 Antibody: synthetic peptide directed towards the N terminal of human ZMYM4. Synthetic peptide located within the following region: QVSVFKSIRKDFSLVRENSKETFSGKEKNRDLTYEREKRLDKPHKDLDSR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 173 kDa
• Gene Name: zinc finger MYM-type containing 4
• Database Link:
  NP_005086
  Q5VZL5
• Background: ZMYM4 regulates apoptosis by altering mRNA turnover and CDIR inhibits apoptosis by acting as a competitive inhibitor of AUF1, preventing AUF1 from binding to its targets.
• Synonyms: CDIR; MYM; ZNF198L3; ZNF262
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 86%; Rabbit: 86%

Reference Data