PDHA2 Rabbit Polyclonal Antibody

SKU
TA335716
Rabbit Polyclonal Anti-PDHA2 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PDHA2 Antibody: synthetic peptide directed towards the N terminal of human PDHA2. Synthetic peptide located within the following region: RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 43 kDa
Gene Name pyruvate dehydrogenase (lipoamide) alpha 2
Database Link
Background The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).
Synonyms PDHAL
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Mouse: 93%; Bovine: 93%; Rat: 86%; Horse: 85%; Dog: 79%; Pig: 79%; Zebrafish: 79%; Guinea pig: 79%
Reference Data
Protein Pathways Butanoate metabolism, Citrate cycle (TCA cycle), Glycolysis / Gluconeogenesis, leucine and isoleucine biosynthesis, Metabolic pathways, Pyruvate metabolism, Valine
Write Your Own Review
You're reviewing:PDHA2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.