PDHA2 Rabbit Polyclonal Antibody

SKU TA335716

Rabbit Polyclonal Anti-PDHA2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PDHA2 Antibody: synthetic peptide directed towards the N terminal of human PDHA2. Synthetic peptide located within the following region: RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: pyruvate dehydrogenase (lipoamide) alpha 2
• Database Link:
  NP_005381
  P29803
• Background: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).
• Synonyms: PDHAL
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Mouse: 93%; Bovine: 93%; Rat: 86%; Horse: 85%; Dog: 79%; Pig: 79%; Zebrafish: 79%; Guinea pig: 79%

Reference Data

• Protein Pathways: Butanoate metabolism, Citrate cycle (TCA cycle), Glycolysis / Gluconeogenesis, leucine and isoleucine biosynthesis, Metabolic pathways, Pyruvate metabolism, Valine