Chromosome X open reading frame 6 (MAMLD1) Rabbit Polyclonal Antibody

SKU TA335712

Rabbit Polyclonal Anti-MAMLD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CXorf6 Antibody: synthetic peptide directed towards the N terminal of human CXorf6. Synthetic peptide located within the following region: SPFVVPQTTEVGLKGPTVPYYEKINSVPAVDQELQELLEELTKIQDPSPN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 83 kDa
• Gene Name: mastermind like domain containing 1
• Database Link:
  NP_005482
  Q13495
• Background: CXorf6 transactivates the HES3 promoter independently of NOTCH proteins. HES3 is a non-canonical NOTCH target gene which lacks binding sites for RBPJ.
• Synonyms: CG1; CXorf6; F18; HYSP2
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Bovine: 86%; Zebrafish: 77%

Reference Data