Chromosome X open reading frame 6 (MAMLD1) Rabbit Polyclonal Antibody

SKU TA335711

Rabbit Polyclonal Anti-MAMLD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CXORF6 Antibody: synthetic peptide directed towards the N terminal of human CXORF6. Synthetic peptide located within the following region: LEELTKIQDPSPNELDLEKILGTKPEEPLVLDHPQATLSTTPKPSVQMSH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 74 kDa
• Gene Name: mastermind like domain containing 1
• Database Link:
  NP_005482
  Q13495
• Background: CXorf6 is a protein predicted based on an ORF found in chromosome 14
• Synonyms: CG1; CXorf6; F18; HYSP2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Rabbit: 86%; Rat: 79%; Mouse: 79%; Guinea pig: 79%

Reference Data