TM9SF1 Rabbit Polyclonal Antibody

SKU TA335690

Rabbit Polyclonal Anti-TM9SF1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TM9SF1 Antibody: synthetic peptide directed towards the N terminal of human TM9SF1. Synthetic peptide located within the following region: EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 67 kDa
• Gene Name: transmembrane 9 superfamily member 1
• Database Link:
  NP_006396
  O15321
• Background: TM9SF1 may function as channel, small molecule transporter or receptor.
• Synonyms: HMP70; MP70
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 92%

Reference Data

• Protein Families: Transmembrane