ZFPL1 Rabbit Polyclonal Antibody

SKU TA335674

Rabbit Polyclonal Anti-ZFPL1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZFPL1 Antibody: synthetic peptide directed towards the middle region of human ZFPL1. Synthetic peptide located within the following region: NGPIFPPTNLAGPVASALREKLATVNWARAGLGLPLIDEVVSPEPEPLNT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: zinc finger protein like 1
• Database Link:
  NP_006773
  O95159
• Background: ZFPL1 is expressed strongly in the exocrine pancreas as a 1.4-kb polyadenylated RNA encoding a putative protein of 310 amino acids.
• Synonyms: D11S750; MCG4
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%

Reference Data

• Protein Families: Transcription Factors, Transmembrane