GTL3 (CFAP20) Rabbit Polyclonal Antibody

SKU TA335646

Rabbit Polyclonal Anti-C16orf80 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GTL3 Antibody: synthetic peptide directed towards the C terminal of human GTL3. Synthetic peptide located within the following region: YGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 23 kDa
• Gene Name: cilia and flagella associated protein 20
• Database Link:
  NP_037374
  Q9Y6A4
• Background: The function of Anti-GTL3 has not yet been determined.
• Synonyms: C16orf80; EVORF; fSAP23; GTL3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 77%

Reference Data

• Protein Families: Transcription Factors