Frequenin (NCS1) Rabbit Polyclonal Antibody

SKU TA335627

Rabbit Polyclonal Anti-NCS1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FREQ Antibody: synthetic peptide directed towards the N terminal of human FREQ. Synthetic peptide located within the following region: MGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 22 kDa
• Gene Name: neuronal calcium sensor 1
• Database Link:
  NP_055101
  P62166
• Background: FREQ is a member of the neuronal calcium sensor gene family, which encode calcium-binding proteins expressed predominantly in neurons. The protein encoded by this gene regulates G protein-coupled receptor phosphorylation in a calcium-dependent manner and can substitute for calmodulin. This protein is thought to be associated with secretory granules and may be involved in the regulation of neurosecretion.
• Synonyms: FLUP; FREQ
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%

Reference Data

• Protein Families: Druggable Genome