D4S234E (NSG1) Rabbit Polyclonal Antibody

SKU TA335626

Rabbit Polyclonal Anti-Nsg1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Nsg1 Antibody is: synthetic peptide directed towards the N-terminal region of Rat Nsg1. Synthetic peptide located within the following region: VKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 20 kDa
• Gene Name: neuronal vesicle trafficking associated 1
• Database Link:
  NP_055207
  P42857
• Background: (brain-specific protein that) may be involved in neuronal fiber networks.
• Synonyms: D4S234; D4S234E; NEEP21; P21
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane