DKKL1 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-DKKL1 Antibody: synthetic peptide directed towards the C terminal of human DKKL1. Synthetic peptide located within the following region: DALEGGHWLSEKRHRLQAIRDGLRKGTHKDVLEEGTESSSHSRLSPRKTH |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 27 kDa |
Gene Name | dickkopf like acrosomal protein 1 |
Database Link | |
Background | The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. DKKL1 is a secreted protein that has high similarity to the N-terminus of the dickkopf-3 protein and moderate similarity to that protein's C-terminus though the C-terminal cysteine residues are not conserved.The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. This gene encodes a secreted protein that has high similarity to the N-terminus of the dickkopf-3 protein and moderate similarity to that protein's C-terminus though the C-terminal cysteine residues are not conserved. |
Synonyms | CT34; SGY; SGY-1; SGY1 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 86%; Dog: 77% |
Reference Data | |
Protein Families | ES Cell Differentiation/IPS, Secreted Protein, Transmembrane |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.