GIMAP2 Rabbit Polyclonal Antibody

SKU TA335586

Rabbit Polyclonal Anti-GIMAP2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GIMAP2 Antibody is: synthetic peptide directed towards the middle region of Human GIMAP2. Synthetic peptide located within the following region: LVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: GTPase, IMAP family member 2
• Database Link:
  NP_056475
  Q9UG22
• Background: This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1.
• Synonyms: HIMAP2; IAN12; IMAP2
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 93%; Mouse: 91%; Rabbit: 91%; Dog: 86%; Pig: 86%; Rat: 85%; Zebrafish: 82%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane