DENND2A Rabbit Polyclonal Antibody

SKU TA335582

Rabbit Polyclonal Anti-DENND2A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DENND2A Antibody is: synthetic peptide directed towards the N-terminal region of Human DENND2A. Synthetic peptide located within the following region: DRSLENVYRGSEGSPTKPFINPLPKPRRTFKHAGEGDKDGKPGIGFRKEK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 113 kDa
• Gene Name: DENN domain containing 2A
• Database Link:
  NP_056504
  Q9ULE3
• Background: DENND2A is a guanine nucleotide exchange factor (GEF) which may activate RAB9A and RAB9B. It promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form and may play a role in late endosomes back to trans-Golgi network/TGN transport.
• Synonyms: FAM31D; KIAA1277
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Bovine: 91%; Dog: 86%; Pig: 86%; Mouse: 86%; Horse: 79%

Reference Data