WDPCP Rabbit Polyclonal Antibody

SKU TA335580

Rabbit Polyclonal Anti-WDPCP Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-WDPCP Antibody: synthetic peptide directed towards the N terminal of human LOC51057. Synthetic peptide located within the following region: LAQNKLCFIQFTKKMESSDVNKRLEKLSALDYKIFYYEIPGPINKTTERH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 68 kDa
• Gene Name: WD repeat containing planar cell polarity effector
• Database Link:
  NP_056994
  O95876
• Background: The specific function of this protein remains unknown.
• Synonyms: BBS15; C2orf86; CHDTHP; FRITZ; FRTZ
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Horse: 92%; Mouse: 91%; Dog: 85%; Bovine: 85%; Rabbit: 79%

Reference Data