TFB1M Rabbit Polyclonal Antibody

SKU TA335573

Rabbit Polyclonal Anti-TFB1M Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TFB1M Antibody: synthetic peptide directed towards the N terminal of human TFB1M. Synthetic peptide located within the following region: NFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGGITRSILNADVAELLVVE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: transcription factor B1, mitochondrial
• Database Link:
  NP_057104
  Q8WVM0
• Background: The transcription of genes from mitochondrial DNA requires a mitochondrial RNA polymerase and a DNA-binding transcription factor. Transcription factor B1 (TFB1M) is a part of this transcription complex. The transcription of genes from mitochondrial DNA requires a mitochondrial RNA polymerase (see POLRMT, MIM 601778) and a DNA-binding transcription factor (see TFAM, MIM 600438). Transcription factor B1 (TFB1M) is a part of this transcription complex. [supplied by OMIM]
• Synonyms: CGI-75; CGI75; mtTFB; mtTFB1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Zebrafish: 85%

Reference Data

• Protein Families: Transcription Factors