SUV420h1 (KMT5B) Rabbit Polyclonal Antibody

SKU TA335571

Rabbit Polyclonal Anti-SUV420H1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SUV420H1 Antibody: synthetic peptide directed towards the middle region of human SUV420H1. Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 99 kDa
• Gene Name: lysine methyltransferase 5B
• Database Link:
  NP_057112
  Q4FZB7
• Background: SUV420H1 is a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined.
• Synonyms: CGI-85; CGI85; SUV420H1
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Mouse: 91%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Lysine degradation