ZFR Rabbit Polyclonal Antibody

SKU TA335567

Rabbit Polyclonal Anti-ZFR Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZFR Antibody: synthetic peptide directed towards the middle region of human ZFR. Synthetic peptide located within the following region: RQIHKVLGMDPLPQMSQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKDYDN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 117 kDa
• Gene Name: zinc finger RNA binding protein
• Database Link:
  NP_057191
  Q96KR1
• Background: ZFR is critical for Staufen 2 isoform specific nucleocytoplasmic shuttling in neurons.
• Synonyms: SPG71; ZFR1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%

Reference Data