ISYNA1 Rabbit Polyclonal Antibody

SKU TA335561

Rabbit Polyclonal Anti-ISYNA1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ISYNA1 Antibody: synthetic peptide directed towards the N terminal of human ISYNA1. Synthetic peptide located within the following region: LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 61 kDa
• Gene Name: inositol-3-phosphate synthase 1
• Database Link:
  NP_057452
  Q9NPH2
• Background: Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate.Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate (Seelan et al., 2004 [PubMed 15464731]). [supplied by OMIM]
• Synonyms: INO1; INOS; IPS; IPS-1; IPS 1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Yeast: 92%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Inositol phosphate metabolism, Metabolic pathways