C14orf101 (TMEM260) Rabbit Polyclonal Antibody

SKU TA335534

Rabbit Polyclonal Anti-TMEM260 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C14ORF101 Antibody: synthetic peptide directed towards the N terminal of human C14ORF101. Synthetic peptide located within the following region: WGDQTTLQGFLTHFLREEYGTFSLAKSEIGSSMSEILLSQVTNMRTELSF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 79 kDa
• Gene Name: transmembrane protein 260
• Database Link:
  NP_060269
  Q9NX78
• Background: C14orf101 is a protein predicted based on an ORF found in chromosome 14.
• Synonyms: C14orf101
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 92%; Rabbit: 86%

Reference Data

• Protein Families: Transmembrane