MANSC1 Rabbit Polyclonal Antibody

SKU TA335527

Rabbit Polyclonal Anti-MANSC1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MANSC1 Antibody: synthetic peptide directed towards the N terminal of human MANSC1. Synthetic peptide located within the following region: LTLRLSASQNCLKKSLEDVVIDIQSSLSKGIRGNEPVYTSTQEDCINSCC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 47 kDa
• Gene Name: MANSC domain containing 1
• Database Link:
  NP_060520
  Q9H8J5
• Background: MANSC1, located on chromosome 12, encodes a protein whose function is not yet defined.
• Synonyms: 9130403P13Rik; LOH12CR3
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 92%; Dog: 90%; Rat: 90%; Mouse: 90%; Bovine: 83%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane