ZA20D3 (ZFAND6) Rabbit Polyclonal Antibody

SKU TA335508

Rabbit Polyclonal Anti-ZFAND6 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZA20D3 Antibody: synthetic peptide directed towards the middle region of human ZA20D3. Synthetic peptide located within the following region: SDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 23 kDa
• Gene Name: zinc finger AN1-type containing 6
• Database Link:
  NP_061879
  Q6FIF0
• Background: ZA20D3 is a zinc-finger protein located on chromosome 15.
• Synonyms: AWP1; ZA20D3; ZFAND5B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data