ANKRD7 Rabbit Polyclonal Antibody

SKU
TA335504
Rabbit Polyclonal Anti-ANKRD7 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ANKRD7 Antibody: synthetic peptide directed towards the middle region of human ANKRD7. Synthetic peptide located within the following region: EYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEKGADVNASDNYQRTAL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 17 kDa
Gene Name ankyrin repeat domain 7
Database Link
Background ANKRD7 contains 5 ANK repeats. The exact function of ANKRD7 remains unknown.
Synonyms TSA806
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 91%; Rat: 79%; Mouse: 77%
Reference Data
Write Your Own Review
You're reviewing:ANKRD7 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.