Fascin 3 (FSCN3) Rabbit Polyclonal Antibody

SKU TA335499

Rabbit Polyclonal Anti-FSCN3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FSCN3 Antibody: synthetic peptide directed towards the C terminal of human FSCN3. Synthetic peptide located within the following region: YDGEVRAASERLNRMSLFQFECDSESPTVQLRSANGYYLSQRRHRAVMAD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: fascin actin-bundling protein 3
• Database Link:
  NP_065102
  Q9NQT6
• Background: FSCN3 acts as an actin bundling protein.
• Synonyms: actin-bundling protein; fascin (testis); fascin 3; fascin homolog 3; OTTMUSP00000023543; testicular (Strongylocentrotus purpuratus)
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Mouse: 86%; Pig: 79%; Rat: 79%; Bovine: 79%

Reference Data