FAM108C1 (ABHD17C) Rabbit Polyclonal Antibody

SKU TA335493

Rabbit Polyclonal Anti-ABHD17C Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM108C1 Antibody is: synthetic peptide directed towards the middle region of Human FAM108C1. Synthetic peptide located within the following region: GSRINCNIFSYDYSGYGVSSGKPSEKNLYADIDAAWQALRTRYGVSPENI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: abhydrolase domain containing 17C
• Database Link:
  NP_067037
  Q6PCB6
• Background: The function of this protein remains unknown.
• Synonyms: FAM108C1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 93%; Guinea pig: 93%; Horse: 86%; Rabbit: 86%

Reference Data

• Protein Families: Protease