DBF4B Rabbit Polyclonal Antibody

SKU TA335453

Rabbit Polyclonal Anti-DBF4B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DBF4B Antibody is: synthetic peptide directed towards the N-terminal region of Human DBF4B. Synthetic peptide located within the following region: SKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 47 kDa
• Gene Name: DBF4 zinc finger B
• Database Link:
  NP_079380
  Q8NFT6
• Background: This gene encodes a regulator of the cell division cycle 7 homolog (S. cerevisiae) protein, a serine-threonine kinase which links cell cycle regulation to genome duplication. This protein localizes to the nucleus and, in complex with the cell division cycle 7 homolog (S. cerevisiae) protein, may facilitate M phase progression.
• Synonyms: ASKL1; CHIFB; DRF1; ZDBF1B
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Pig: 79%

Reference Data