Asrgl1 Rabbit Polyclonal Antibody

SKU
TA335448
Rabbit Polyclonal Anti-Asrgl1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Asrgl1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALFHVEQGKTVEEAAQLALDYMKSKLKGLGGLILVNKTGDWVAKWTSASM
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 36 kDa
Gene Name asparaginase like 1
Database Link
Background Asrgl1 acts in asparagine catabolism. Asrgl1 may be involved in astroglial production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions.
Synonyms ALP; ALP1; CRASH; FLJ22316
Note Immunogen Sequence Homology: Human: 100%; Mouse: 86%; Rabbit: 86%; Horse: 85%; Pig: 80%; Guinea pig: 80%; Rat: 79%; Zebrafish: 79%
Reference Data
Write Your Own Review
You're reviewing:Asrgl1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.