FAM130A1 (CSRNP2) Rabbit Polyclonal Antibody

SKU TA335443

Rabbit Polyclonal Anti-CSRNP2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CSRNP2 Antibody is: synthetic peptide directed towards the C-terminal region of Human CSRNP2. Synthetic peptide located within the following region: EPENEDFHPSWSPSSLPFRTDNEEGCGMVKTSQQNEDRPPEDSSLELPLA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 59 kDa
• Gene Name: cysteine and serine rich nuclear protein 2
• Database Link:
  NP_110436
  Q9H175
• Background: The protein encoded by this gene belongs to the CSRNP family of nuclear proteins that share conserved regions, including cysteine- and serine- rich regions, a basic domain, a transcriptional activation domain, and bind the sequence 'AGAGTG', thus have the hallmark of transcription factors. Studies in mice suggest that these genes may have redundant functions. Alternatively spliced transcript variants have been found for this gene.
• Synonyms: C12orf2; C12orf22; FAM130A1; PPP1R72; TAIP-12
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rat: 83%; Rabbit: 75%

Reference Data