FAM105B (OTULIN) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-FAM105B Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM105B. Synthetic peptide located within the following region: NRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLE |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 38 kDa |
Gene Name | OTU deubiquitinase with linear linkage specificity |
Database Link | |
Background | FAM105B is a deubiquitinase that specifically removes linear ('M-1'-linked) polyubiquitin chains to substrates and acts as a regulator of angiogenesis. It associates with the LUBAC complex via direct interaction with RNF31 and counteracts its action by cleaving linear polyubiquitin chains to substrates. It is required during angiogenesis, craniofacial and neuronal development by regulating the canonical Wnt signaling together with the LUBAC complex. FAM105B acts as a negative regulator of NF-kappa-B by counteracting activity of the LUBAC complex |
Synonyms | AIPDS; FAM105B; GUM |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Guinea pig: 85% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.