PRSS21 Rabbit Polyclonal Antibody

SKU
TA335395
Rabbit Polyclonal Anti-PRSS21 Antibody
$585.00
2 Weeks*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PRSS21 Antibody: synthetic peptide directed towards the N terminal of human PRSS21. Synthetic peptide located within the following region: RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 33 kDa
Gene Name protease, serine 21
Database Link
Background This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. It is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and it may be involved in progression of testicular tumors of germ cell origin. Alternative splicing of this gene results in three transcript variants encoding three different isoforms.
Synonyms ESP-1; ESP1; TEST1; TESTISIN
Note Immunogen Sequence Homology: Human: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Pig: 83%; Guinea pig: 83%
Reference Data
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:PRSS21 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.