ATP11C Rabbit Polyclonal Antibody

SKU TA335364

Rabbit Polyclonal Anti-Atp11c Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Atp11c Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GLKVWVLTGDKMETAKSTCYACRLFQTNTELLELTTKTIEESERKEDRLH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 129 kDa
• Gene Name: ATPase phospholipid transporting 11C
• Database Link:
  NP_775965
  Q8NB49
• Background: The function of Atp11c remains unknown.
• Synonyms: ATPIG; ATPIQ
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%

Reference Data

• Protein Families: Transmembrane