CBX7 Rabbit Polyclonal Antibody

SKU TA335362

Rabbit Polyclonal Anti-CBX7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CBX7 Antibody: synthetic peptide directed towards the middle region of human CBX7. Synthetic peptide located within the following region: ADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 28 kDa
• Gene Name: chromobox 7
• Database Link:
  NP_783640
  O95931
• Background: CBX7 is involved in maintaining the transcriptionally repressive state of genes. Modifies chromatin, rendering it heritably changed in its expressibility. This protein is regulator of cellular lifespan by maintaining the repression of CDKN2A, but not by inducing telomerase activity.
• Synonyms: chromobox homolog 7; OTTHUMP00000028984
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%

Reference Data