ENPP7 Rabbit Polyclonal Antibody

SKU TA335355

Rabbit Polyclonal Anti-ENPP7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ENPP7 Antibody is: synthetic peptide directed towards the N-terminal region of Human ENPP7. Synthetic peptide located within the following region: WITAQRQGLRAGSFFYPGGNVTYQGVAVTRSRKEGIAHNYKNETEWRANI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: ectonucleotide pyrophosphatase/phosphodiesterase 7
• Database Link:
  NP_848638
  Q6UWV6
• Background: ENPP7 converts sphingomyelin to ceramide. It also has phospholipase C activity toward palmitoyl lyso-phosphocholine and does not appear to have nucleotide pyrophosphatase activity.
• Synonyms: 339221; ALK-SMase; E-NPP 7; NPP-7; NPP7
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Mouse: 86%

Reference Data

• Protein Pathways: Metabolic pathways, Sphingolipid metabolism