IMPDH1 Rabbit Polyclonal Antibody

SKU TA335348

Rabbit Polyclonal Anti-IMPDH1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-IMPDH1 Antibody: synthetic peptide directed towards the middle region of human IMPDH1. Synthetic peptide located within the following region: KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 62 kDa
• Gene Name: IMP (inosine 5'-monophosphate) dehydrogenase 1
• Database Link:
  NP_899066
  P20839
• Background: IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).
• Synonyms: IMPD; IMPD1; IMPDH-I; LCA11; RP10; sWSS2608
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism