FMO3 Rabbit Polyclonal Antibody

SKU TA335295

Rabbit Polyclonal Anti-FMO3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FMO3 antibody: synthetic peptide directed towards the N terminal of human FMO3. Synthetic peptide located within the following region: FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 59 kDa
• Gene Name: flavin containing monooxygenase 3
• Database Link:
  NP_001002294
  P31513
• Background: FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide.
• Synonyms: dJ127D3.1; FMOII; TMAU
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Rabbit: 93%; Guinea pig: 90%; Horse: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Drug metabolism - cytochrome P450