GPR177 (WLS) Rabbit Polyclonal Antibody

SKU
TA335293
Rabbit Polyclonal Anti-GPR177 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GPR177 antibody: synthetic peptide directed towards the middle region of human GPR177. Synthetic peptide located within the following region: DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 62 kDa
Gene Name wntless Wnt ligand secretion mediator
Database Link
Background GPR177 has signal transducer activity. It is positive regulation of I-kappaB kinase/NF-kappaB cascade.
Synonyms C1orf139; EVI; GPR177; mig-14; MRP
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:GPR177 (WLS) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.