SRD5A2 Rabbit Polyclonal Antibody

SKU TA335223

Rabbit Polyclonal Anti-SRD5A2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivity: Human, Monkey
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 28 kDa
• Gene Name: steroid 5 alpha-reductase 2
• Database Link:
  NP_000339
  P31213
• Background: This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH). [provided by RefSeq, Jul 2008]
• Synonyms: MGC138457
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 91%; Pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Androgen and estrogen metabolism, Prostate cancer