TFIIF (GTF2F1) Rabbit Polyclonal Antibody

SKU
TA335218
Rabbit Polyclonal Anti-GTF2F1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GTF2F1 antibody: synthetic peptide directed towards the N terminal of human GTF2F1. Synthetic peptide located within the following region: DKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKY
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 58 kDa
Gene Name general transcription factor IIF subunit 1
Database Link
Background GTF2F1 is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation.
Synonyms BTF4; RAP74; TF2F1; TFIIF
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 90%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Basal transcription factors
Write Your Own Review
You're reviewing:TFIIF (GTF2F1) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.