BRDT Rabbit Polyclonal Antibody

SKU TA335205

Rabbit Polyclonal Anti-BRDT Antibody

Product Data

• Application: IHC
• Recommended Dilution: IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BRDT antibody: synthetic peptide directed towards the N terminal of human BRDT. Synthetic peptide located within the following region: MSLPSRQTAIIVNPPPPEYINTKKNGRLTNQLQYLQKVVLKDLWKHSFSW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 108 kDa
• Gene Name: bromodomain testis associated
• Database Link:
  NP_001717
  Q58F21
• Background: BRDT is similar to the RING3 protein family. It possesses 2 bromodomain motifs and a PEST sequence (a cluster of proline, glutamic acid, serine, and threonine residues), characteristic of proteins that undergo rapid intracellular degradation. The bromodomain is found in proteins that regulate transcription. Two transcript variants encoding the same protein have been found for this gene.
• Synonyms: BRD6; CT9
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Rabbit: 93%; Horse: 86%

Reference Data

• Protein Families: Protein Kinase, Transcription Factors