HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Chicken, Human, Mouse |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the middle region of human HIF1A. Synthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 93 kDa |
Gene Name | hypoxia inducible factor 1 alpha subunit |
Database Link | |
Background | This gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in energy metabolism, angiogenesis, apoptosis, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2011] |
Synonyms | bHLHe78; HIF-1-alpha; HIF-1A; HIF-1alpha; HIF1; HIF1-ALPHA; MOP1; PASD8 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | mTOR signaling pathway, Pathways in cancer, Renal cell carcinoma |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.