FAM190A (CCSER1) Rabbit Polyclonal Antibody

SKU TA335111

Rabbit polyclonal Anti-MGC48628 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MGC48628 antibody: synthetic peptide directed towards the N terminal of human MGC48628. Synthetic peptide located within the following region: HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 74 kDa
• Gene Name: coiled-coil serine rich protein 1
• Database Link:
  NP_997374
  Q9C0I3
• Background: The specific function of the protein remains unknown.
• Synonyms: FAM190A
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Guinea pig: 93%; Rabbit: 92%; Rat: 86%; Mouse: 86%; Dog: 79%

Reference Data